PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG369700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 248aa    MW: 27117.8 Da    PI: 8.2951
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG369700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1897151256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq   Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Pavir.9NG369700.1.p  97 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTK 151
                          78889************************************************98 PP

2HD-ZIP_I/II124.55e-4097185190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rl+keq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++L+ +
  Pavir.9NG369700.1.p  97 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENRRLHRELQQLH-A 185
                          69*************************************************************************************8.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1981154IPR009057Homeodomain-like
PROSITE profilePS5007117.18493153IPR001356Homeobox domain
SMARTSM003891.1E-1595157IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-1895156IPR009057Homeodomain-like
CDDcd000865.55E-1797154No hitNo description
PfamPF000465.9E-1697151IPR001356Homeobox domain
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PfamPF021839.8E-10153186IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.7E-19153196IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEQEEVGLAL GLSLGSGPYQ LKEQPSPSSH SGTLLEPSSL SLGLPAKDSP AAPVRIAAVK  60
RELRMEDYDE ATDRALYSVA SSALVVAPDD DEGCNSRKKL RLTKEQSALL EDRFKEHSTL  120
NPKQKAALAK QLNLRPRQVE VWFQNRRART KLKQTEVDCE LLKRCCETLT EENRRLHREL  180
QQLHALNHPH TAAFFMPAAT LSICPSCERL TGVPAAAATT NGADRPKPSG PGRATHLFNP  240
FTNSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101SRKKLRL
2145153RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.216851e-162leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0545801e-123BT054580.1 Zea mays full-length cDNA clone ZM_BFc0164J19 mRNA, complete cds.
GenBankEU9620301e-123EU962030.1 Zea mays clone 239717 homeobox-leucine zipper protein HAT22 mRNA, complete cds.
GenBankKJ7276181e-123KJ727618.1 Zea mays clone pUT5529 HB transcription factor (HB121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983488.11e-140PREDICTED: homeobox-leucine zipper protein HOX15-like
SwissprotA2Z4C45e-86HOX15_ORYSI; Homeobox-leucine zipper protein HOX15
SwissprotQ7G7375e-86HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLK4AE821e-140K4AE82_SETIT; Uncharacterized protein
STRINGSi037189m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.15e-67HD-ZIP family protein